Galanin rat, CAS [[114547-31-8]]

Product Overview

• Article Name: Galanin rat, CAS [[114547-31-8]]
• Biozol Catalog Number: ECH-475-25-5MG
• Supplier Catalog Number: 475-25-5mg
• Alternative Catalog Number: ECH-475-25-5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 114547-31-8Molecular Weight: 3162.6Salt Form: TFAPurity: >96%Sequence (3-letter): Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Ile-Asp-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-His-Gly-Leu-Thr-NH2Sequence (1-letter): GWTLNSAGYLLGPHAIDNHRSFSDKHGLT-NH2Storage: -20 AC or belowGalanin is a non-selective agonist that binds the GAL1 GAL2 and GAL3 receptors and inhibits cAMP production. It has been shown to be an anticonvulsant in rats that prevents fully kindled seizures.

Product Properties

• Tag: 1196 1178
• CAS Number: [114547-31-8]