Vasoactive Intestinal Peptide [Lys1 Pro2 5 Arg3 4 Tyr6] / VIP Antagonist, CAS [[125093-93-8]]

Catalog Number: ECH-491-32-1MG
Article Name: Vasoactive Intestinal Peptide [Lys1 Pro2 5 Arg3 4 Tyr6] / VIP Antagonist, CAS [[125093-93-8]]
Biozol Catalog Number: ECH-491-32-1MG
Supplier Catalog Number: 491-32-1mg
Alternative Catalog Number: ECH-491-32-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 125093-93-8Molecular Weight: 3467.12Salt Form: TFAPurity: >96%Sequence (3-letter): Lys-Pro-Arg-Arg-Pro-Tyr-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2Sequence (1-letter): KPRRPYTDNYTRLRKQMAVKKYLNSILN-NH2Storage: -20 AC or belowVasoactive Intestinal Peptide (VIP) is a peptide hormone which has several roles in both the body and the brain. VIP induces smooth muscle relaxation stimulates water secretion and inhibits gastric juice secretion in the digestive system. VIP plays a key role as a synchronizing agent in the suprachiasmatic nuclei (SCN) which controls the circadian rhythm. The Lys1 Pro2 5 Arg3 4 Tyr6 analog is a potent VIP antagonist.
Tag: 1178
CAS Number: [125093-93-8]