CAS Number: 96849-38-6Molecular Weight: 3009.6Salt Form: TFAPurity: >96%Sequence (3-letter): His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2Sequence (1-letter): HADGVFTSDYSRLLGQISAKKYLESLI-NH2Storage: -20 AC or belowPHI aka Intestinal peptide PHI-27 is a member of the vasoactive intestinal peptide (VIP) family of peptides. It is has been shown to regulate feeding behavior and prolactin secretion.
Tag:
1191
CAS Number:
[96849-38-6]
* VAT and and shipping costs not included. Errors and price changes excepted