PHI rat, CAS [[96849-38-6]]

Product Overview

• Article Name: PHI rat, CAS [[96849-38-6]]
• Biozol Catalog Number: ECH-495-25-0.5MG
• Supplier Catalog Number: 495-25-0.5mg
• Alternative Catalog Number: ECH-495-25-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 96849-38-6Molecular Weight: 3009.6Salt Form: TFAPurity: >96%Sequence (3-letter): His-Ala-Asp-Gly-Val-Phe-Thr-Ser-Asp-Tyr-Ser-Arg-Leu-Leu-Gly-Gln-Ile-Ser-Ala-Lys-Lys-Tyr-Leu-Glu-Ser-Leu-Ile-NH2Sequence (1-letter): HADGVFTSDYSRLLGQISAKKYLESLI-NH2Storage: -20 AC or belowPHI aka Intestinal peptide PHI-27 is a member of the vasoactive intestinal peptide (VIP) family of peptides. It is has been shown to regulate feeding behavior and prolactin secretion.

Product Properties

• Tag: 1191
• CAS Number: [96849-38-6]