Exendin-4, CAS [[141758-74-9]]

Product Overview

• Article Name: Exendin-4, CAS [[141758-74-9]]
• Biozol Catalog Number: ECH-507-77-1MG
• Supplier Catalog Number: 507-77-1mg
• Alternative Catalog Number: ECH-507-77-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 141758-74-9Molecular Weight: 4184.04Salt Form: TFAPurity: >95%Sequence (3-letter): His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2Sequence (1-letter): HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2Storage: -20 AC or belowExendin-4 is an incretin mimetic peptide and A an analog of glucagon-like peptide 1 (GLP-1). The mimetic activity of Exendin-4 controls insulin secretion in a glucose-dependent manner.Publications Powered by Bioz See more details on Bioz

Product Properties

• Tag: 1196 1178
• CAS Number: [141758-74-9]