Exendin 3 (9-39) Fragment, CAS [[133514-43-9]]

Product Overview

• Article Name: Exendin 3 (9-39) Fragment, CAS [[133514-43-9]]
• Biozol Catalog Number: ECH-507-81-1MG
• Supplier Catalog Number: 507-81-1mg
• Alternative Catalog Number: ECH-507-81-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 133514-43-9Molecular Weight: 3367.69Salt Form: TFAPurity: >96%Sequence (3-letter): Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2Sequence (1-letter): DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2Storage: -20 AC or belowExendin 3 (9-39) is a truncated form of Exendin 4 that acts as a potent and selective GLP-1 receptor antagonist.

Product Properties

• Tag: 1196 1178
• CAS Number: [133514-43-9]