Growth Hormone Releasing Factor GRF (1-44) amide human, CAS [[83930-13-6]]

Product Overview

• Article Name: Growth Hormone Releasing Factor GRF (1-44) amide human, CAS [[83930-13-6]]
• Biozol Catalog Number: ECH-531-66-1MG
• Supplier Catalog Number: 531-66-1mg
• Alternative Catalog Number: ECH-531-66-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 83930-13-6Molecular Weight: 5036.66Salt Form: TFAPurity: >95%Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-Arg-Ala-Arg-Leu-NH2Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL(NH2)Storage: -20 AC or belowGrowth Hormone Releasing Factor (GRF) (1-44) is a 44-aminoacid peptide hormone released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone.

Product Properties

• Tag: 1196
• CAS Number: [83930-13-6]