Growth Hormone Releasing Factor (GRF) (1-40) amide human

Catalog Number: ECH-531-67-0.5MG
Article Name: Growth Hormone Releasing Factor (GRF) (1-40) amide human
Biozol Catalog Number: ECH-531-67-0.5MG
Supplier Catalog Number: 531-67-0.5mg
Alternative Catalog Number: ECH-531-67-0.5MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 4540.34 Salt Form: TFA Purity: >95% Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-NH2 Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA(NH2) Storage: -20 AC or belowGrowth Hormone Releasing Factor (GHRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.
Tag: 1196 1178