Growth Hormone Releasing Factor (GRF) (1-40) human, CAS [[84069-10-3]]

Catalog Number: ECH-531-68-1MG
Article Name: Growth Hormone Releasing Factor (GRF) (1-40) human, CAS [[84069-10-3]]
Biozol Catalog Number: ECH-531-68-1MG
Supplier Catalog Number: 531-68-1mg
Alternative Catalog Number: ECH-531-68-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 84069-10-3 Molecular Weight: 4541.32 Salt Form: TFA Purity: >95% Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Ser-Asn-Gln-Glu-Arg-Gly-Ala-OH Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGA(OH) Storage: -20 AC or belowGrowth Hormone Releasing Factor (GHRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.
Tag: 1196 1178
CAS Number: [84069-10-3]