Growth Hormone Releasing Factor (GRF) (1-29) amide human, CAS [[86168-78-7]]

Catalog Number: ECH-531-75-1MG
Article Name: Growth Hormone Releasing Factor (GRF) (1-29) amide human, CAS [[86168-78-7]]
Biozol Catalog Number: ECH-531-75-1MG
Supplier Catalog Number: 531-75-1mg
Alternative Catalog Number: ECH-531-75-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 86168-78-7 Molecular Weight: 3355.82 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 Storage: -20 AC or belowGrowth Hormone Releasing Factor (GHRF or GRF) is a peptide that stimulates the release of growth hormone via GPCR receptor GHRH-R. N-terminal fragments and modified fragments are used to study the biological roles of GHRF.
Tag: 1196 1178
CAS Number: [86168-78-7]