Growth Hormone Releasing Factor (GRF) (1-44) porcine, CAS [[88384-73-0]]

Catalog Number: ECH-534-29-1MG
Article Name: Growth Hormone Releasing Factor (GRF) (1-44) porcine, CAS [[88384-73-0]]
Biozol Catalog Number: ECH-534-29-1MG
Supplier Catalog Number: 534-29-1mg
Alternative Catalog Number: ECH-534-29-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 88384-73-0 Molecular Weight: 5105.72 Salt Form: TFA Purity: >96% Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Arg-Val-Arg-Leu-NH2 Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2 Storage: -20 AC or belowGrowth Hormone Releasing Factor (GRF) (1-44) is a 44-aminoacid peptide hormone released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone. This is the porcine form.
Tag: 1196 1178
CAS Number: [88384-73-0]