Growth Hormone Releasing Factor GRF (1-44) amide human bovine, CAS [[88894-91-1]]

Product Overview

• Article Name: Growth Hormone Releasing Factor GRF (1-44) amide human bovine, CAS [[88894-91-1]]
• Biozol Catalog Number: ECH-535-15-0.5MG
• Supplier Catalog Number: 535-15-0.5mg
• Alternative Catalog Number: ECH-535-15-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 88894-91-1Molecular Weight: 5107.86Salt Form: TFAPurity: >96%Sequence (3-letter): Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Asn-Arg-Gln-Gln-Gly-Glu-Arg-Asn-Gln-Glu-Gln-Gly-Ala-Lys-Val-Arg-Leu-NH2Sequence (1-letter): YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2Storage: -20 AC or belowGrowth Hormone Releasing Factor (GRF or GHRF) is released by the hypothalamus to stimulate the secretion of growth hormone. The bovine form shares ~90% identity with human GRF.

Product Properties

• Tag: 1196 1178
• CAS Number: [88894-91-1]