Growth Hormone Releasing Factor (GHRF) mouse

Product Overview

• Article Name: Growth Hormone Releasing Factor (GHRF) mouse
• Biozol Catalog Number: ECH-536-10-1MG
• Supplier Catalog Number: 536-10-1mg
• Alternative Catalog Number: ECH-536-10-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

Growth Hormone Releasing Factor (GHRF somatocrinin) is a peptide hormone produced in the arcuate nucleus of the hypothamlus. It binds to the GHRH receptor in the anterior pituitary gland and subsequently stimulates growth hormone secretion.Molecular Weight: 5029.72Salt Form: TFAPurity: >96%Sequence (3-letter): His-Val-Asp-Ala-Ile-Phe-Thr-Thr-Asn-Tyr-Arg-Lys-Leu-Leu-Ser-Gln-Leu-Tyr-Ala-Arg-Lys-Val-Ile-Gln-Asp-Ile-Met-Asn-Lys-Gln-Gly-Glu-Arg-Ile-Gln-Glu-Gln-Arg-Ala-Arg-Leu-Ser-OHSequence (1-letter): HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS-OHStorage: -20 AC or below

Product Properties

• Tag: 1196 1178