Neuropeptide Y (3-36) human rat / NPY (3-36), CAS [[150138-78-6]]

Catalog Number: ECH-614-41-0.5MG
Article Name: Neuropeptide Y (3-36) human rat / NPY (3-36), CAS [[150138-78-6]]
Biozol Catalog Number: ECH-614-41-0.5MG
Supplier Catalog Number: 614-41-0.5mg
Alternative Catalog Number: ECH-614-41-0.5MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 150138-78-6Molecular Weight: 4008.98Salt Form: TFAPurity: >95%Sequence (3-letter): Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2Sequence (1-letter): SKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2Storage: -20 AC or belowNeuropeptide Y (NPY) is a 36-aa neuropeptide that acts as a neurotransmitter in the brain and in the autonomic nervous system of humans. It binds to a family of g-protein coupled receptors Y1-Y6 to regulate a variety of functions including feeding behavior and pain perception. Neuropeptide Y (3-36) binds selectively to Y1 and Y5.
Tag: 1178
CAS Number: [150138-78-6]