Molecular Weight: 4327.18Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHStorage: -20 AC or belowHexafluoroisopropanol (HFIP) treatment of Beta Amyloid (1-40) (Cat 641-10) removes preexisting structures (b-sheets aggregation ...) in the lyophilized peptide and is important for controlled aggregation studies. The peptide appears as a clear film in the vial.
Tag:
1202 1192
* VAT and and shipping costs not included. Errors and price changes excepted