Beta Amyloid [Glu11] (1-40) human - HFIP

Catalog Number: ECH-641-01-1MG
Article Name: Beta Amyloid [Glu11] (1-40) human - HFIP
Biozol Catalog Number: ECH-641-01-1MG
Supplier Catalog Number: 641-01-1mg
Alternative Catalog Number: ECH-641-01-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
Molecular Weight: 4327.18Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OHStorage: -20 AC or belowHexafluoroisopropanol (HFIP) treatment of Beta Amyloid (1-40) (Cat 641-10) removes preexisting structures (b-sheets aggregation ...) in the lyophilized peptide and is important for controlled aggregation studies. The peptide appears as a clear film in the vial.
Tag: 1202 1192