Beta Amyloid [Glu11] (1-40), human

Product Overview

• Article Name: Beta Amyloid [Glu11] (1-40), human
• Biozol Catalog Number: ECH-641-10
• Supplier Catalog Number: 641-10
• Alternative Catalog Number: ECH-641-10-0.5MG,ECH-641-10-1MG,ECH-641-10-25MG,ECH-641-10-5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 131438-79-4 Molecular Weight: 4327.18 Salt Form: TFA Purity: >96% Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH Sequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-OH Storage: -20 ?C or below Solubility: ?water, 1mg/ml Beta amyloid (1-40), along with beta amyloid (1-42) (catalog 641-15) is one of the two main variants of the amyloid ? peptide involved in Alzheimers disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimers disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models.

References

1. Roher, A. et al. (1996) ?Morphology and Toxicity of Ab-(1?42) Dimer Derived from Neuritic and Vascular Amyloid Deposits of Alzheimer?s Disease? J. Biol. Chem. 34: 20631?20635. 2.Tennent, G.A., Lovat, L.B. and Pepys, M.B. (1995) ?Serum amyloid P component prevents proteolysis of the amyloid fibrils of Alzheimer disease and systemic amyloidosis? Proc. Natl. Acad. Sci. USA 92: 4299-4303. 3. Strittmatter, W.J. et at (1993) ?Apolipoprotein E: High-avidity binding to ,B-amyloid and increased frequency of type 4 allele in late-onset familial Alzheimer disease? Proc. Natl. Acad. Sci. USA 90: 1977-1981. 4. Scheuner, D. et al (1996) ?Secreted amyloid bold ?-protein similar to that in the senile plaques of Alzheimers disease is increased in vivo by the presenilin 1 and 2 and APP mutations linked to familial Alzheimers disease? Nat. Med. 2: 864 ? 870.

Application Notes

• Application Notes: Categories: Peptides. Related: Alzheimers, Central Nervous System. Ship 1 : Shipping Temp. Ship 2: Ambient Temperature