Molecular Weight: 4309.22Salt Form: TFAPurity: >96%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Nle-Val-Gly-Gly-Val-Val-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL(Nle)VGGVV-OHStorage: -20 AC or belowBeta amyloid (1-40) along with beta amyloid (1-42) is one of the two main variants of the amyloid i peptide involved in Alzheimera€(TM)s disease. Beta amyloid (1-40) is a peptide that is found in plaques in the brains of patients with Alzheimera€(TM)s disease and is shown to have both neurotrophic and neurotoxic effects in human and rat cell culture models. This analog has Nle instead of Met at position 35 resulting in a peptide that has the same propensity to aggregate but is non-toxic to hippocampal neurons.
Tag:
1202 1192
* VAT and and shipping costs not included. Errors and price changes excepted
