Beta Amyloid (1-42) human (Arctic) [Gly22], CAS [[107761-42-2]]

Catalog Number: ECH-641-22-1MG
Article Name: Beta Amyloid (1-42) human (Arctic) [Gly22], CAS [[107761-42-2]]
Biozol Catalog Number: ECH-641-22-1MG
Supplier Catalog Number: 641-22-1mg
Alternative Catalog Number: ECH-641-22-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 107761-42-2Molecular Weight: 4439.28Salt Form: TFAPurity: >95%Sequence (3-letter): Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Gly-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OHSequence (1-letter): DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA-OHStorage: -20 AC or belowBeta amyloid (1-42) is the predominant form of i-amyloid protein found in the brains of patients with Alzheimera€s disease and Downa€s syndrome. Beta Amyloid (1-42) human (Arctic) [Gly22] contains the Gly22 Arctic mutation which causes early onset of Alzheimera€s compared to wild type Beta amyloid (1-42).
Tag: 1202 1192
CAS Number: [107761-42-2]