Beta Amyloid (42-1) reverse human, CAS [[317366-82-8]]

Product Overview

• Article Name: Beta Amyloid (42-1) reverse human, CAS [[317366-82-8]]
• Biozol Catalog Number: ECH-641-69-1MG
• Supplier Catalog Number: 641-69-1mg
• Alternative Catalog Number: ECH-641-69-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 317366-82-8Molecular Weight: 4514.12Salt Form: TFAPurity: >95%Sequence (3-letter): Ala-Ile-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OHSequence (1-letter): AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OHStorage: -20 AC or belowBeta amyloid (42-1) is the reverse of beta amyloid (1-42) and is used as an inactive control peptide for beta amyloid (1-42).

Product Properties

• Tag: 1202 1192
• CAS Number: [317366-82-8]