Beta Amyloid (40-1) reverse human, CAS [[144409-99-4]]

Product Overview

• Article Name: Beta Amyloid (40-1) reverse human, CAS [[144409-99-4]]
• Biozol Catalog Number: ECH-641-70-1MG
• Supplier Catalog Number: 641-70-1mg
• Alternative Catalog Number: ECH-641-70-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 144409-99-4Molecular Weight: 4327.18Salt Form: TFAPurity: >95%Sequence (3-letter): Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OHSequence (1-letter): VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD-OHStorage: -20 AC or belowBeta Amyloid (40-1) is an inactive control peptide for Beta Amyloid (1-40). The synthetic sequence is derived from the human Beta Amyloid (1-40).

Product Properties

• Tag: 1202 1192
• CAS Number: [144409-99-4]