CAS Number: 89468-62-2Molecular Weight: 3841.14Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2Sequence (1-letter): HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2Storage: -20 AC or belowHelodermin [Gln8 9] is structurally similar to vasoactive intestinal polypeptide (VIP) from the venom of the lizard Heloderma suspectum. Helodermin exhibits vasodilatory and antihypertensive activities by increasing intracellular cAMP.
Tag:
1180
CAS Number:
[89468-62-2]
* VAT and and shipping costs not included. Errors and price changes excepted