Helodermin [Gln8 9], CAS [[89468-62-2]]

Product Overview

• Article Name: Helodermin [Gln8 9], CAS [[89468-62-2]]
• Biozol Catalog Number: ECH-740-27-1MG
• Supplier Catalog Number: 740-27-1mg
• Alternative Catalog Number: ECH-740-27-1MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

CAS Number: 89468-62-2Molecular Weight: 3841.14Salt Form: TFAPurity: >95%Sequence (3-letter): His-Ser-Asp-Ala-Ile-Phe-Thr-Gln-Gln-Tyr-Ser-Lys-Leu-Leu-Ala-Lys-Leu-Ala-Leu-Gln-Lys-Tyr-Leu-Ala-Ser-Ile-Leu-Gly-Ser-Arg-Thr-Ser-Pro-Pro-Pro-NH2Sequence (1-letter): HSDAIFTQQYSKLLAKLALQKYLASILGSRTSPPP-NH2Storage: -20 AC or belowHelodermin [Gln8 9] is structurally similar to vasoactive intestinal polypeptide (VIP) from the venom of the lizard Heloderma suspectum. Helodermin exhibits vasodilatory and antihypertensive activities by increasing intracellular cAMP.

Product Properties

• Tag: 1180
• CAS Number: [89468-62-2]