CAS Number: 83930-33-0Molecular Weight: 4866.46Salt Form: TFAPurity: >95%Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Ile-Glu-Asn-Glu-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2Storage: -20 AC or belowUrotensin I suckerfish is related to mammalian urocortin and is involved in the regulation of cortisol and stress responses in teleost fish (e.g. suckerfish or white sucker). It releases ACTH from cultured mammalian cells by binding to CRF1 and CRF2 receptors.Publication Powered by Bioz See more details on Bioz
Tag:
1178
CAS Number:
[83930-33-0]
* VAT and and shipping costs not included. Errors and price changes excepted