Urotensin I carp

Product Overview

• Article Name: Urotensin I carp
• Biozol Catalog Number: ECH-817-40-0.5MG
• Supplier Catalog Number: 817-40-0.5mg
• Alternative Catalog Number: ECH-817-40-0.5MG
• Manufacturer: Echelon Biosciences
• Category: Molekularbiologie

Product Description

Molecular Weight: 4866.44Salt Form: TFAPurity: >95%Sequence (3-letter): Asn-Asp-Asp-Pro-Pro-Ile-Ser-Ile-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Asn-Met-Ile-Glu-Met-Ala-Arg-Asn-Glu-Asn-Gln-Arg-Glu-Gln-Ala-Gly-Leu-Asn-Arg-Lys-Tyr-Leu-Asp-Glu-Val-NH2Sequence (1-letter): NDDPPISIDLTFHLLRNMIEMARNENQREQAGLNRKYLDEV-NH2Storage: -20 AC or belowUrotensin I carp is a peptide ligand for the corticotrophin-releasing factor (CRF) receptor. It is used to study its immunoregulatory activities in fish.

Product Properties

• Tag: 1178