Calmodulin Kinase II Inhibitor (281-309), CAS [[116826-37-0]]

Catalog Number: ECH-893-40-1MG
Article Name: Calmodulin Kinase II Inhibitor (281-309), CAS [[116826-37-0]]
Biozol Catalog Number: ECH-893-40-1MG
Supplier Catalog Number: 893-40-1mg
Alternative Catalog Number: ECH-893-40-1MG
Manufacturer: Echelon Biosciences
Category: Molekularbiologie
CAS Number: 116826-37-0Molecular Weight: 3371.86Salt Form: AcetatePurity: >96%Sequence (3-letter): Met-His-Arg-Gln-Glu-Thr-Val-Asp-Cys-Leu-Lys-Lys-Phe-Asn-Ala-Arg-Arg-Lys-Leu-Lys-Gly-Ala-Ile-Leu-Thr-Thr-Met-Leu-Ala-OHSequence (1-letter): MHRQETVDCLKKFNARRKLKGAILTTMLA-OHStorage: -20 AC or belowCalmodulin Kinase II Inhibitor (281-309) [CaMKII(281-309)] is a peptide fragment containing the calmodulin binding site (290-309) and the phosphorylation site (Thr286). CaMKII(281-309). It is useful as a calmodulin binding peptide and can act as an inhibitor of CaM kinase II (IC50A = 80 nM) by blocking Ca2+/calmodulin activation and enzyme active site. Alternative name: Calmodulin Dependent Protein Kinase II (281-309)ReferencesWaxham MN Aronowski J (1993) Ca2+/calmodulin-dependent protein kinase II is phosphorylated by protein kinase C in vitro. Biochemistry 32(11):2923-30
Tag: 1311 1216 172 61
CAS Number: [116826-37-0]