E2F1 Antibody, Unconjugated, Rabbit, Polyclonal
Catalog Number:
FBX-E2F1-101AP
| Article Name: |
E2F1 Antibody, Unconjugated, Rabbit, Polyclonal |
| Biozol Catalog Number: |
FBX-E2F1-101AP |
| Supplier Catalog Number: |
E2F1-101AP |
| Alternative Catalog Number: |
FBX-E2F1-101AP-100 |
| Manufacturer: |
FabGennix |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ELISA, WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
| Conjugation: |
Unconjugated |
| Alternative Names: |
E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, retinoblastoma-associated protein 1, retinoblastoma-binding protein 3, transcription factor E2F1 |
| Clonality: |
Polyclonal |
| Isotype: |
IgG |
| NCBI: |
1869 |
| UniProt: |
Q01094 |
| Purity: |
Affinity Purified |
| Target: |
E2F1 |
|
E2F1-101AP |