ACTH Blocking Peptide
Catalog Number:
FBX-P-ACTH
- Images (1)
| Article Name: | ACTH Blocking Peptide |
| Biozol Catalog Number: | FBX-P-ACTH |
| Supplier Catalog Number: | P-ACTH |
| Alternative Catalog Number: | FBX-P-ACTH-250 |
| Manufacturer: | FabGennix |
| Category: | Biochemikalien |
| Application: | Immunocompetition, Immunodepletion |
| Immunogen: | Synthetic peptide corresponding to ACTH aa 138-176. Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| ACTH Blocking Peptide |
| UniProt: | UPI00004EBE53 |
| Target: | ACTH |
|
|
P-ACTH |
Product Guarantee and Expert Support
