E2F1 Blocking Peptide
Catalog Number:
FBX-P-E2F1N
| Article Name: |
E2F1 Blocking Peptide |
| Biozol Catalog Number: |
FBX-P-E2F1N |
| Supplier Catalog Number: |
P-E2F1n |
| Alternative Catalog Number: |
FBX-P-E2F1N-250 |
| Manufacturer: |
FabGennix |
| Category: |
Biochemikalien |
| Application: |
Immunocompetition, Immunodepletion |
| Species Reactivity: |
Human |
| Immunogen: |
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
| Alternative Names: |
E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, retinoblastoma-associated protein 1, retinoblastoma-binding protein 3, transcription factor E2F1 |
![]()
|
P-E2F1n |
