E2F1 Blocking Peptide

Catalog Number: FBX-P-E2F1N
Article Name: E2F1 Blocking Peptide
Biozol Catalog Number: FBX-P-E2F1N
Supplier Catalog Number: P-E2F1n
Alternative Catalog Number: FBX-P-E2F1N-250
Manufacturer: FabGennix
Category: Biochemikalien
Application: Immunocompetition, Immunodepletion
Species Reactivity: Human
Immunogen: Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD
Alternative Names: E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, retinoblastoma-associated protein 1, retinoblastoma-binding protein 3, transcription factor E2F1
E2F1 Blocking Peptide
NCBI: 1869
UniProt: Q01094
Target: E2F1
P-E2F1n