Rab11A antibody [4H9], IgG2b, Unconjugated, Mouse, Monoclonal

Catalog Number: GTX03669
Article Name: Rab11A antibody [4H9], IgG2b, Unconjugated, Mouse, Monoclonal
Biozol Catalog Number: GTX03669
Supplier Catalog Number: GTX03669
Alternative Catalog Number: GTX03669-100
Manufacturer: GeneTex
Host: Mouse
Category: Antikörper
Application: FC, ICC, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human Rab11A (171-211aa EIYRIVSQKQMSDRRENDMSPSNNVVPIHVPPTTENKPKVQ), identical to the related mouse and rat sequences.
Conjugation: Unconjugated
Alternative Names: RAB11A, member RAS oncogene family , YL8
Clonality: Monoclonal
Concentration: 0.5 mg/ml (Please refer to the vial label for the specific concentration.)
Clone Designation: [4H9]
Molecular Weight: 24
Isotype: IgG2b
NCBI: 8766
UniProt: P62491
Buffer: 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, no preservatives.
Form: Liquid
Application Notes: WB: 0.25-0.5 µg/ml. ICC/IF: 5 µg/ml. IHC-P: 2-5 µg/ml. FCM: 1-3 µg/1x106cells. *Optimal dilutions/concentrations should be determined by the researcher.Not tested in other applications.