LL 37 (human) biotinylated

Catalog Number: ISC-AM-003
Article Name: LL 37 (human) biotinylated
Biozol Catalog Number: ISC-AM-003
Supplier Catalog Number: AM-003
Alternative Catalog Number: ISC-AM-003
Manufacturer: Isca Biochemicals
Category: Biochemikalien
LL 37 (human) biotinylated is the N-terminally biotinylated version of the host defence peptide LL 37. The biotin group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the biotin tag allows numerous biochemical and microbiological applications. We also offer unlabelled LL 37 (AM-001) and the carboxyfluoresceinated version of LL 37 (AM-004).
Molecular Weight: 4832.5
NCBI: 2013
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: Biotin-Ahx[LL-37, 37 aa]
Formula: C221H366N64O55S
Target: Antibacterials
Application Notes: ProductType: Biotin labelled peptides