LL 37 (human), 5-FAM

Catalog Number: ISC-AM-004
Article Name: LL 37 (human), 5-FAM
Biozol Catalog Number: ISC-AM-004
Supplier Catalog Number: AM-004
Alternative Catalog Number: ISC-AM-004
Manufacturer: Isca Biochemicals
Category: Biochemikalien
LL 37 (human), 5-FAM is the N-terminally carboxyfluoresceinated derivative of the host defence peptide LL 37. The carboxyfluorescein group is attached via a 6-carbon spacer, 6-aminohexanoic acid (Ahx). The presence of the carboxyfluorescein tag allows fluorescent detection of LL 37. We also offer unlabelled LL 37 (AM-001) and the biotinylated version of LL 37 (AM-003).
Molecular Weight: 4963.6
NCBI: 2013
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: 5FAM-Ahx[LL-37, 37 aa]
Formula: C226H351N61O58
Target: Antibacterials
Application Notes: ProductType: Fluorescent labelled peptides