Candidalysin, CAS [[1906866-53-2]]

Catalog Number: ISC-AM-390
Article Name: Candidalysin, CAS [[1906866-53-2]]
Biozol Catalog Number: ISC-AM-390
Supplier Catalog Number: AM-390
Alternative Catalog Number: ISC-AM-390
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Ece1-III62-92K , CL
Candidalysin is a peptide generated by kexin-like proteinase posttranslational processing of the 271-amino-acid preproprotein Ece1p, and is the dominant peptide secreted by the pathogen Candida albicans hyphae during mucosal infection. Candidalysin is a cytolytic peptide toxin that causes epithelial cell damage and activates downstream inflammatory responses inducing c-Fos, p-MKP1, cytokines (IL-1alpha, G-CSF) and calcium influx. Candidalysin is critical for mucosal and systemic infections and is a key driver of host cell activation, neutrophil recruitment and Type 17 immunity. Candidalysin is a classical virulence factor of C. albicans but also triggers protective immune responses in the host organism. C. albicans strains lacking candidalysin do not activate or damage epithelial cells and are avirulent in animal models of mucosal infection.
Molecular Weight: 3310.16
NCBI: 2016
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: SIIGIIMGILGNIPQVIQIIMSIVKAFKGNK
CAS Number: [1906866-53-2]
Formula: C153H266N38O38S2
Target: Antifungals
Application Notes: ProductType: Peptides