Exendin-4, CAS [[141758-74-9]]

Catalog Number: ISC-GH-001
Article Name: Exendin-4, CAS [[141758-74-9]]
Biozol Catalog Number: ISC-GH-001
Supplier Catalog Number: GH-001
Alternative Catalog Number: ISC-GH-001
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Exenatide
Exendin-4, also known as exenatide, is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist originally isolated from Heloderma suspectum venom. It has 50% amino acid homology to GLP-1 and a longer half-life in vivo, and potentiates glucose-induced insulin secretion in isolated rat islets. Exenatide is used to treat type 2 diabetes mellitus as an add-on treatment and has also been evaluated for the treatment of Parkinsons disease.
Molecular Weight: 4186.6
NCBI: 1992
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
CAS Number: [141758-74-9]
Formula: C184H282N50O60S
Target: Glucagon and related receptors
Application Notes: ProductType: Peptides