Exendin-4 (5-39) amide

Catalog Number: ISC-GH-009
Article Name: Exendin-4 (5-39) amide
Biozol Catalog Number: ISC-GH-009
Supplier Catalog Number: GH-009
Alternative Catalog Number: ISC-GH-009
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Exendin-4 (5-39) is an antagonist of glucagon-like peptide 1 (GLP-1) receptors. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide. Unlike the full length exendin-4, a GLP-1 agonist, exendin (5-39) antagonizes GLP-1 stimulated insulin release after food intake. Exendin (5-39) also modulates synaptic transmission via glutamate uptake in the dentate gyrus and improves memory impairment in beta-amyloid protein-treated rats.
Molecular Weight: 3806.2
NCBI: 2013
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2
Formula: C169H262N44O54S
Target: Glucagon and related receptors
Application Notes: ProductType: Peptides