GLP-1 (1-36) amide, CAS [[99658-04-5]]
Catalog Number:
ISC-GH-030
| Article Name: |
GLP-1 (1-36) amide, CAS [[99658-04-5]] |
| Biozol Catalog Number: |
ISC-GH-030 |
| Supplier Catalog Number: |
GH-030 |
| Alternative Catalog Number: |
ISC-GH-030 |
| Manufacturer: |
Isca Biochemicals |
| Category: |
Biochemikalien |
| GLP-1 (1-36) amide is the posttranslational product of proteolysis of proglucagon (72-107) |
| Molecular Weight: |
4111.5 |
| NCBI: |
1991 |
| Purity: |
>95% by HPLC |
| Form: |
Freeze dried solid |
| Sequence: |
HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2 |
| CAS Number: |
[99658-04-5] |
| Formula: |
C184H273N51O57 |
| Target: |
Glucagon and related receptors |
| Application Notes: |
ProductType: Peptides |
