GLP-1 (7-36) amide (human, rat), CAS [[107444-51-9]]

Catalog Number: ISC-GH-050
Article Name: GLP-1 (7-36) amide (human, rat), CAS [[107444-51-9]]
Biozol Catalog Number: ISC-GH-050
Supplier Catalog Number: GH-050
Alternative Catalog Number: ISC-GH-050
Manufacturer: Isca Biochemicals
Category: Biochemikalien
GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells with a Kd of 204 pM. GLP-1 (7-36) amide stimulates insulin gene transcription and secretion in pancreatic beta-cells, displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.
Molecular Weight: 3297.7
NCBI: 2000
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2
CAS Number: [107444-51-9]
Formula: C149H226N40O45
Target: Glucagon and related receptors
Application Notes: ProductType: Peptides