GIP (human), CAS [[100040-31-1]]

Catalog Number: ISC-GH-150
Article Name: GIP (human), CAS [[100040-31-1]]
Biozol Catalog Number: ISC-GH-150
Supplier Catalog Number: GH-150
Alternative Catalog Number: ISC-GH-150
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide
GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake and while it is weak inhibitor of gastric acid secretion, its main role is to stimulate insulin release. Type 2 diabetics are not responsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In mice, absence of GIP receptors correlates with resistance to obesity.
Molecular Weight: 4983.6
NCBI: 1995
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
CAS Number: [100040-31-1]
Formula: C226H338N60O66S
Target: Glucagon and related receptors
Application Notes: ProductType: Peptides