GIP (1-39), CAS [[725474-97-5]]

Catalog Number: ISC-GH-160
Article Name: GIP (1-39), CAS [[725474-97-5]]
Biozol Catalog Number: ISC-GH-160
Supplier Catalog Number: GH-160
Alternative Catalog Number: ISC-GH-160
Manufacturer: Isca Biochemicals
Category: Biochemikalien
GIP (1-39) is a highly potent insulinotropic peptide, it is the endogenous truncated form of the incretin hormone GIP (Glucose-dependent Insulinotropic Polypeptide, or Gastric Inhibitory Polypeptide), a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP (1-39) is more potent at stimulating glucose-dependent insulin secretion from rat pancreatic beta-cells than GIP and loss of the incretin effect is an early characteristic of type 2 diabetes
Molecular Weight: 4633.2
NCBI: 2004
Purity: >95% By HPLC
Form: Freeze dried solid
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN
CAS Number: [725474-97-5]
Formula: C210H316N56O61S
Target: Glucagon and related receptors
Application Notes: ProductType: Peptides