GIP-1 (3-42) (human), CAS [[1802086-25-4]]

Catalog Number: ISC-GH-170
Article Name: GIP-1 (3-42) (human), CAS [[1802086-25-4]]
Biozol Catalog Number: ISC-GH-170
Supplier Catalog Number: GH-170
Alternative Catalog Number: ISC-GH-170
Manufacturer: Isca Biochemicals
Category: Biochemikalien
GIP (3-42) is produced by cleavage of the first two amino acid residues at the N-terminal (Tyr1-Ala2) from GIP (1-42), also known as GIP, by the serine protease dipeptidyl peptidase IV (DPP-IV). GIP (3-42) itself has no biological activity, but it can compete with GIP for the receptor binding site, resulting in GIP receptor (GIPR) inhibition.
Molecular Weight: 4749.4
NCBI: 2006
Purity: >95% by HPLC
Form: Freeze dried solid
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
CAS Number: [1802086-25-4]
Formula: C214H324N58O63S
Target: Glucagon and related receptors
Application Notes: ProductType: Peptides