PACAP 38, CAS [[124123-15-5]]

Catalog Number: ISC-PA-020
Article Name: PACAP 38, CAS [[124123-15-5]]
Biozol Catalog Number: ISC-PA-020
Supplier Catalog Number: PA-020
Alternative Catalog Number: ISC-PA-020
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Pituitary Adenylate Cyclase-Activating Polypeptide 1-38, PACAP 1-38
PACAP 38, or Pituitary adenylate cyclase activating polypeptide-38, is a widely distributed endogenous neuropeptide located in both sensory and parasympathetic perivascular nerve fibes. PACAP 38 acts primarily as a PAC1 agonist and is involved in neuroprotection, neurodevelopment, nociception and inflammation. PACAP 38 is a potent inducer of migraine like attacks in migraineurs and headache in non migraineurs.
Molecular Weight: 4534.32
NCBI: 1998
Purity: 95% by hplc
Form: Freeze dried solid
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH,,
CAS Number: [124123-15-5]
Formula: C,,,€,fH,f,f,N,+,fO,_,fS
Target: PACAP receptors
Application Notes: ProductType: Peptides