Tat-beclin 1, CAS [[1423821-88-8]]

Catalog Number: ISC-PP-200
Article Name: Tat-beclin 1, CAS [[1423821-88-8]]
Biozol Catalog Number: ISC-PP-200
Supplier Catalog Number: PP-200
Alternative Catalog Number: ISC-PP-200
Manufacturer: Isca Biochemicals
Category: Biochemikalien
Alternative Names: Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide
Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.
Molecular Weight: 3741.15
NCBI: 2013
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT
CAS Number: [1423821-88-8]
Formula: C164H251N57O45
Target: Protein-protein interactions,Antivirals
Application Notes: ProductType: Cell penetrating peptides