TAT-HuR-HNS3

Catalog Number: ISC-PP-370
Article Name: TAT-HuR-HNS3
Biozol Catalog Number: ISC-PP-370
Supplier Catalog Number: PP-370
Alternative Catalog Number: ISC-PP-370
Manufacturer: Isca Biochemicals
Category: Biochemikalien
TAT-HuR-HNS3 is a cell penetrating peptide derived from the human antigen R - nucleocytoplasmic shuttling sequence (HuR-HNS) domain. HuR, also known as embryonic lethal abnormal vision-like 1 (ELAVL1) is a well characterized RNA-binding protein that increases the stability of short lived mRNAs which encode proinflammatory mediators. HuR employs its HNS domain to interact with poly(ADP-ribose) polymerase 1 (PARP1), and intervention by TAT-HuR-HNS3 interrupts this interaction, resulting in lower poly-ADP-ribosylation and decreased cytoplasmic distribution of HuR. TAT-HuR-HNS3 also blocks HuR dimerization and promotes argonaute 2-based miRNA induced silencing complex binding. TAT-HuR-HNS3 lowers the mRNA stability of proini,ammatory mediators in TNF-alpha treated epithelial cells and macrophages, and decreases TNF-alpha induced inflammatory responses in animal lung models.
Molecular Weight: 3696.9
NCBI: 2022
Purity: >95% by hplc
Form: Freeze dried solid
Sequence: YGRKKRRQRRRSPMGVDHMSGLSGVNVPGNASSG
Formula: C151H257N59O46S2
Target: Protein-protein interactions
Application Notes: ProductType: Cell penetrating peptides