Monoclonal Mouse anti-Human ATXN1 / SCA1 Antibody (clone S76-8, Biotin, aa164-197, IHC, WB) LS-C229235

Catalog Number: LS-C229235-100
Article Name: Monoclonal Mouse anti-Human ATXN1 / SCA1 Antibody (clone S76-8, Biotin, aa164-197, IHC, WB) LS-C229235
Biozol Catalog Number: LS-C229235-100
Supplier Catalog Number: LS-C229235-100
Alternative Catalog Number: LS-C229235-100
Manufacturer: LifeSpan Biosciences
Host: Mouse
Category: Antikörper
Application: IHC, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1 (Accession No. P54254). Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical). Percent identity by BLAST analysis:
Conjugation: Biotin
Alternative Names: ATXN1, ATX1, Ataxin 1, D6S504E, Ataxin-1, SCA1
SCA1 antibody LS-C229235 is a biotin-conjugated mouse monoclonal antibody to SCA1 (ATXN1) (aa164-197) from human. It is reactive with human, mouse and rat. Validated for IHC, IP and WB.
Clonality: Monoclonal
Concentration: 1 mg/ml
Clone Designation: [S76-8]
Isotype: IgG2b
NCBI: 6310
Buffer: PBS, pH 7.4, 0.1% Sodium Azide, 50% Glycerol
Purity: Protein G purified from tissue culture supernatant
Form: PBS, pH 7.4, 0.1% Sodium Azide, 50% Glycerol
Application Dilute: IHC, IP, WB
Application Notes: The applications listed have been tested for the unconjugated form of this product. Other forms have not been tested.