Polyclonal Rabbit anti-Human BAX Antibody (IHC, IF, WB) LS-C330831

Product Overview

• Article Name: Polyclonal Rabbit anti-Human BAX Antibody (IHC, IF, WB) LS-C330831
• Biozol Catalog Number: LS-C330831-100
• Supplier Catalog Number: LS-C330831-100
• Alternative Catalog Number: LS-C330831-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC, WB
• Species Reactivity: Human, Mouse
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human BAX (NP_620116.1). MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNMELQRMIAAVDTDSPREVFFRVAADMF
• Conjugation: Unconjugated
• Alternative Names: BAX, BCL2-associated X protein, Bcl2-L-4, Apoptosis regulator BAX, Bcl-2-like protein 4, BCL2L4

Product Description

BAX antibody LS-C330831 is an unconjugated rabbit polyclonal antibody to BAX from human. It is reactive with human and mouse. Validated for IF, IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 581
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: IF, IHC (1:50 - 1:100), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 4kDa/12kDa/15kDa/18kDa/19kDa/21kDa/24kDa, while the observed MW by Western blot was 21kDa.

Images

Western blot analysis of extract