Polyclonal Rabbit anti-Human SUMO1 / SMT3 Antibody (IHC, IF, WB) LS-C331925

Product Overview

• Article Name: Polyclonal Rabbit anti-Human SUMO1 / SMT3 Antibody (IHC, IF, WB) LS-C331925
• Biozol Catalog Number: LS-C331925-100
• Supplier Catalog Number: LS-C331925-100
• Alternative Catalog Number: LS-C331925-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-101 of human SUMO1 (NP_003343.1). MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHSTV
• Conjugation: Unconjugated
• Alternative Names: SUMO1, GAP modifying protein 1, GMP1, OFC10, Sentrin, SMT3 homolog 3, SMT3C, SMT3H3, SUMO-1, Ubiquitin-like protein UBL1, PIC1, Ubiquitin-like 1 (sentrin), UBL1, DAP1, GAP-modifying protein 1, Ubiquitin-like protein SMT3C

Product Description

SMT3 antibody LS-C331925 is an unconjugated rabbit polyclonal antibody to SMT3 (SUMO1) from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 7341
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:100), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 8kDa/11kDa, while the observed MW by Western blot was 11kDa.

Images

Western blot analysis of extracts of HeLa cells.

Immunohistochemistry of paraffin-embedded rat testis.

Immunofluorescence analysis of MCF7 cells.