Histone H3 Antibody LS-C332079, Unconjugated, Polyclonal

Product Overview

• Article Name: Histone H3 Antibody LS-C332079, Unconjugated, Polyclonal
• Biozol Catalog Number: LS-C332079-100
• Supplier Catalog Number: LS-C332079-100
• Alternative Catalog Number: LS-C332079-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: ChIP, IF, IHC, IP, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50 to the C-Terminus of human HIST3H3 (NP_003484.1). REIRRYQKSTELLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTIMPKDIQLARRIRGERA
• Conjugation: Unconjugated

Product Description

Histone H3 antibody LS-C332079 is an unconjugated rabbit polyclonal antibody to Histone H3 from human. It is reactive with human, mouse and rat. Validated for ChIP-Seq, ChrIP, IF, IHC, IP and WB.

Product Properties

• Clonality: Polyclonal
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: ChIP-Seq (1:50 - 1:200), ChrIP, IF (1:50 - 1:200), IHC (1:50 - 1:200), IP (1:20 - 1:50), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 15kDa, while the observed MW by Western blot was 17kDa.

Images

Western blot analysis of extracts of various cells.

Immunohistochemistry of paraffin-embedded Rat liver tissue.

Immunoprecipitation analysis of 150ug extracts of MCF7 cells.