Polyclonal Rabbit anti-Human GJA4 / CX37 / Connexin 37 Antibody (WB) LS-C332143

Product Overview

• Article Name: Polyclonal Rabbit anti-Human GJA4 / CX37 / Connexin 37 Antibody (WB) LS-C332143
• Biozol Catalog Number: LS-C332143-20
• Supplier Catalog Number: LS-C332143-20
• Alternative Catalog Number: LS-C332143-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 229-333 of human GJA4 (NP_002051.2). VHLLCRCLSRGMRARQGQDAPPTQGTSSDPYTDQVFFYLPVGQGPSSPPCPTYNGLSSSEQNWANLTTEERLASSRPPLFLDPPPQNGQKPPSRPSSSASKKQYV
• Conjugation: Unconjugated
• Alternative Names: GJA4, Connexin-37, Gap junction protein alpha 4, Gap junction alpha-4 protein, Connexin 37, CX37

Product Description

Connexin 37 antibody LS-C332143 is an unconjugated rabbit polyclonal antibody to human Connexin 37 (GJA4 / CX37). Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 2701
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 37kDa, while the observed MW by Western blot was 43kDa.

Images

Western blot analysis of extracts of various cell lines.