SUMO2 Antibody LS-C332176, Unconjugated, Polyclonal

Product Overview

• Article Name: SUMO2 Antibody LS-C332176, Unconjugated, Polyclonal
• Biozol Catalog Number: LS-C332176-20
• Supplier Catalog Number: LS-C332176-20
• Alternative Catalog Number: LS-C332176-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: IF, IHC, WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human SUMO2 (NP_008868.3). MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY
• Conjugation: Unconjugated
• Alternative Names: SUMO2, HSMT3, SMT3 homolog 2, SMT3A, Sentrin 2, Smt3B, SMT3H2, SUMO-2, SUMO-3, Sentrin-2, Ubiquitin-like protein SMT3A, Ubiquitin-like protein SMT3B

Product Description

SUMO2 antibody LS-C332176 is an unconjugated rabbit polyclonal antibody to SUMO2 from human. It is reactive with human, mouse and rat. Validated for IF, IHC and WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 6613
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: IF (1:50 - 1:200), IHC (1:50 - 1:200), WB (1:500 - 1:2000)
• Application Notes: The predicted MW is 8kDa/10kDa, while the observed MW by Western blot was 17kDa.

Images

Western blot analysis of extracts of various cell lines, using SUMO2 antibody.

Immunofluorescence analysis of U2OS cell using SUMO2 antibody. Blue: DAPI for nuclear staining.

Immunohistochemistry of paraffin-embedded rat lung tissue.