Polyclonal Rabbit anti-Human DBH/Dopamine Beta Hydroxylase Antibody (WB) LS-C332224

Product Overview

• Article Name: Polyclonal Rabbit anti-Human DBH/Dopamine Beta Hydroxylase Antibody (WB) LS-C332224
• Biozol Catalog Number: LS-C332224-100
• Supplier Catalog Number: LS-C332224-100
• Alternative Catalog Number: LS-C332224-100
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse, Rat
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human DBH (NP_000778.3). PFGTCDPKDYLIEDGTVHLVYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQAPNIQIPSQETTYWCYIKELPKGFSRHHIIKYE
• Conjugation: Unconjugated
• Alternative Names: DBH, DBM, Dopamine beta-hydroxylase

Product Description

Dopamine Beta Hydroxylase antibody LS-C332224 is an unconjugated rabbit polyclonal antibody to Dopamine Beta Hydroxylase (DBH) from human. It is reactive with human, mouse and rat. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 1621
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:1000)
• Application Notes: The predicted MW is 69kDa, while the observed MW by Western blot was 79kDa.

Images

Western blot analysis of extracts of various cells.