Polyclonal Rabbit anti-Human NEUROG3 / NGN3 / Neurogenin 3 Antibody (WB) LS-C332242

Product Overview

• Article Name: Polyclonal Rabbit anti-Human NEUROG3 / NGN3 / Neurogenin 3 Antibody (WB) LS-C332242
• Biozol Catalog Number: LS-C332242-20
• Supplier Catalog Number: LS-C332242-20
• Alternative Catalog Number: LS-C332242-20
• Manufacturer: LifeSpan Biosciences
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human, Mouse
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-83 of human NEUROG3 (NP_066279.2). MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSRPKSELALSKQRRS
• Conjugation: Unconjugated
• Alternative Names: NEUROG3, BHLHa7, Atoh5, Math4B, Neurogenin-3, NGN-3, Ngn3, Neurogenin 3, Protein atonal homolog 5

Product Description

Neurogenin 3 antibody LS-C332242 is an unconjugated rabbit polyclonal antibody to Neurogenin 3 (NEUROG3 / NGN3) from human. It is reactive with human and mouse. Validated for WB.

Product Properties

• Clonality: Polyclonal
• NCBI: 50674
• Buffer: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
• Purity: Affinity purified
• Form: PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol

Application Notes

• Application Dilute: WB (1:500 - 1:1000)
• Application Notes: The predicted MW is 23kDa, while the observed MW by Western blot was 23kDa.

Images

Western blot analysis of extracts of mouse testis tissue, using NEUROG3 antibody.